A practical reference on BDNF expression: what it is, how it behaves, what the literature reports, and where the honest uncertainties sit.
This page was last updated on 2025-11-29 and is reviewed periodically as new material appears.
The mechanisms attributed to semax are inferred from animal and cell studies rather than traced to one confirmed target. The most frequently cited pathway involves increased expression of brain-derived neurotrophic factor and nerve growth factor in hippocampal and cortical tissue. Some work points to engagement of melanocortin receptors, particularly MC4, which the parent ACTH fragment can activate. Effects on dopaminergic and serotonergic signalling have also been reported. No single account explains all observed results, and the relative weight of each pathway remains unsettled.
Published studies examine a fairly narrow set of endpoints. Rodent experiments commonly measure maze learning, infarct volume after induced ischemia, and tissue levels of neurotrophic factors. Clinical reports from Russian centres describe attention, memory and recovery scores in patients after stroke or transient ischemic attack. Most of those human studies are small and few have been repeated by independent groups. Outcome measures differ between studies, which limits direct comparison.
Circulation time for the peptide is short because peptidases cleave it readily. The Pro-Gly-Pro tail is thought to slow breakdown compared with the bare ACTH fragment, but the gain appears modest. Absorption after intranasal dosing is limited, and only a fraction of a dose is expected to reach the central nervous system. Laboratory concentrations therefore sit well above levels achieved systemically, a gap that complicates translation from bench findings to clinical claims.
Semax is a synthetic heptapeptide developed in the Soviet Union during the 1980s by researchers at the Institute of Molecular Genetics in Moscow. It was designed as a truncated analog of adrenocorticotropic hormone, retaining only the fragment spanning residues four through ten. Investigators sought a peptide that would preserve the cognitive effects associated with ACTH while eliminating the hormonal stimulation of the adrenal cortex. The compound entered clinical use in Russia during the following decade.
Russian regulatory authorities approved the peptide for nasal administration, and it remains listed in the national pharmacopoeia under several trade names. Documented indications include acute ischemic stroke, transient ischemic attacks, traumatic brain injury, and certain ophthalmological and neurological conditions. Physicians also prescribe it for cognitive complaints in older patients, although the evidence base for that use is thinner. Outside Russia and a few neighboring states, the substance is not an approved medicine and is sold instead as a research chemical.
Later generations of the molecule include an N-acetylated form and an amidated form, both marketed online alongside the parent peptide. These variants differ in terminal chemistry and stability, and they are frequently discussed in the same breath even though they have not been compared in controlled trials. Supply outside formal healthcare systems comes largely from laboratories that synthesize peptides to order. Purity and identity of these materials vary widely, and no single body oversees the international trade.
| Property | Value | Notes |
|---|---|---|
| Appearance | White to off-white powder | Lyophilized solid from research suppliers |
| Solubility | Freely soluble in water | Also dissolves in aqueous buffers; solutions are used fresh |
| Typical storage temperature | -20 °C for lyophilized powder | Short-term transport at 2-8 °C is common |
| Common analytical method | Reverse-phase HPLC | Paired with mass spectrometry for identity confirmation |
| Common synonyms | ACTH(4-10) analogue; MEHFPGP | N-terminal methionine retained in the chain |
The peptide is prone to several degradation pathways. Oxidation of the methionine residue produces a sulfoxide that elutes close to the parent peak in many chromatographic systems. Hydrolysis of peptide bonds and deamidation of susceptible residues in related sequences also reduce purity over time. Lyophilised material kept dry at minus twenty degrees Celsius and shielded from light is the most stable form commonly described in laboratory practice.
Material sold for laboratory use varies widely in stated purity and documentation. A certificate of analysis should list the analytical method, the column and detector used, and the observed purity value. Independent verification by an outside laboratory is the practical way to confirm identity when documentation is absent or internally inconsistent. Regulatory status differs by country, and a product legal in one jurisdiction may be unapproved or controlled in another.
Clinical reports describe use in ischaemic stroke, transient ischaemic attack, optic nerve conditions, and cognitive complaints, but most of these studies are small and were conducted in a single region. Systematic reviews have generally described the evidence base as limited in size and variable in methodological quality. Randomised controlled data suitable for international regulatory assessment are scarce. As a result, major treatment guidelines outside Russia do not include the peptide, and interest in it remains largely research-driven rather than routine clinical.
Semax is a synthetic heptapeptide with the sequence Met-Glu-His-Phe-Pro-Gly-Pro. It is described in the literature as an analogue of the ACTH(4–10) fragment, a short N-terminal portion of adrenocorticotropic hormone that retains some neurotropic activity without the full hormonal effects of the parent peptide. The molecule carries a methionine residue at the N-terminus and two proline residues near the C-terminus, features that shape both its interactions with receptor systems and its chemical stability. The free peptide corresponds to the formula C37H51N9O10S and a molecular mass near 813.9 Da.
The compound was developed in the 1980s at the Institute of Molecular Genetics in Moscow, where it emerged from research on short ACTH fragments and their effects on the central nervous system. Russian pharmaceutical listings describe it as a nootropic and neuroprotective agent, most often formulated as nasal drops. It is not a marketed medicine in the United States or the European Union, and no pharmacopoeial monograph covers it. Consequently, most published clinical experience with the substance originates from a small number of research centres, mainly in Russia and neighbouring countries.
=== Other psychoactive effects === Some psychedelics have been associated with other psychoactive effects in addition to their hallucinogenic effects. For example, psychedelics like LSD and DOM have been described as having mild stimulant and/or "psychic-energizing" (i.e., acute antidepressant) effects. Some psychedelics and related drugs, like DOET (low doses), Ariadne, and ASR-2001 (2CB-5PrO), have been investigated specifically for such effects. 2C-B has been said to have mild entactogenic effects at low doses. 5-MeO-DiPT and 5-MeO-MiPT have unique and unusual effects at typical doses including tactile and sexual enhancement, mild entactogenic effects, and only light hallucinogenic effects. Uniquely among psychedelics, LSD shows biphasic effects and two temporally distinct phases of effects, including an initial psychedelic state and a delayed "paranoid" or psychosis-like state. LSD's delayed second phase of effects is associated with dopamine D2-like receptor agonism, most likely due to the highly potent dopamine D4 receptor agonism of its metabolite 13-hydroxy-LSD. Some drugs, such as MDxx compounds like MDMA and MDA as well as α-alkyltryptamines like α-methyltryptamine (AMT), are entactogens and/or stimulants acting at monoamine transporters in addition to having varying degrees of psychedelic effects.
Part of the WADA submission to the appeal, which the CAS accepted in its verdict, was that Thymosin Beta-4 was the only form of Thymosin which would have had the soft tissue recovery effect that Dank had attributed to it – text messages from Dank had specifically described Thymosin as the cornerstone of the soft tissue recovery program. Two urine samples taken from Essendon players during 2012 were also found to contain elevated Thymosin Beta-4; the levels were not high enough to fail the drug test, but they added to the cable of evidence against the players. Significantly, the CAS also determined that the players were "significantly at fault", disqualifying them from any penalty reduction. This was considered a surprise, as press throughout the entire saga had opined that by having followed the direction of club officials, the players would be found to have had no significant fault or negligence, qualifying them for a 50% penalty reduction. Key to this finding was the revelation that none of the eighteen different players who had been drug tested on a total of thirty occasions during the program had declared the supplements injections on their doping control forms, and that some had withheld information from the club doctor on Dank's instruction – revelations which damaged the credibility of other evidence put forward by the players.
They can then be further refined to a capsule or tablet. The exact composition of a herbal product is influenced by the extraction method. A tea will be rich in polar components because water is a polar solvent. Oil, on the other hand, is a non-polar solvent and it will absorb non-polar compounds. Alcohol lies somewhere in between.
Sources: en.wikipedia.org
=== Blocking === Blocking occurs when a well-established poleward high-pressure system lies near or within the path of the advancing storm system. The thicker the cold air mass is, the more effectively it can block an invading milder air mass. The depth of the cold air mass is normally shallower than the mountain barrier which created the CAD. Some events across the Intermountain West can last for ten days. Pollutants and smoke can remain suspended within the stable air mass of a cold air dam.
First, the price of oil rose catastrophically in 1974, so that its cost per barrel was five times greater than it had been two years earlier. Second, despite continuing hunger around the world, anticipated demand also began to shift from humans to animals. The program had begun with the vision of growing food for Third World people, yet the product was instead launched as an animal food for the developed world. The rapidly rising demand for animal feed made that market appear economically more attractive. The ultimate downfall of the SCP project, however, came from public resistance. This was particularly vocal in Japan, where production came closest to fruition. For all their enthusiasm for innovation and traditional interest in microbiologically produced foods, the Japanese were the first to ban the production of single-cell proteins. The Japanese ultimately were unable to separate the idea of their new "natural" foods from the far from natural connotation of oil. These arguments were made against a background of suspicion of heavy industry in which anxiety over minute traces of petroleum was expressed. Thus, public resistance to an unnatural product led to the end of the SCP project as an attempt to solve world hunger. Also, in 1989 in the USSR, the public environmental concerns made the government decide to close down (or convert to different technologies) all 8 paraffin-fed-yeast plants that the Soviet Ministry of Microbiological Industry had by that time. In the late 1970s, biotechnology offered another possible solution to a societal crisis.
== Prevalence == A number of studies have examined the prevalence of link rot within the World Wide Web, in academic literature that uses URLs to cite web content, and within digital libraries. In a 2023 study of the Million Dollar Homepage external links, it was found that 27% of the links resulted in a site loading with no redirects, 45% of links have been redirected, and 28% returned various error messages. A 2002 study suggested that link rot within digital libraries is considerably slower than on the web. The article found that about 3% of the objects were no longer accessible after one year, equating to a half-life of nearly 23 years. A 2003 study found that on the Web, about one link out of every 200 broke each week, suggesting a half-life of 138 weeks. This rate was largely confirmed by a 2016–2017 study of links in Yahoo! Directory (which had stopped updating in 2014 after 21 years of development) that found the half-life of the directory's links to be two years. A 2004 study showed that subsets of Web links (such as those targeting specific file types or those hosted by academic institutions) could have dramatically different half-lives. The URLs selected for publication appear to have greater longevity than the average URL. A 2015 study by Weblock analyzed more than 180,000 links from references in the full-text corpora of three major open access publishers and found a half-life of about 14 years, generally confirming a 2005 study that found that half of the URLs cited in D-Lib Magazine articles were active 10 years after publication.
=== Intracellular receptors === Intracellular receptors exist freely in the cytoplasm, nucleus, or can be bound to organelles or membranes. For example, the presence of nuclear and mitochondrial receptors is well documented. The binding of a ligand to the intracellular receptor typically induces a response in the cell. Intracellular receptors often have a level of specificity, this allows the receptors to initiate certain responses when bound to a corresponding ligand. Intracellular receptors typically act on lipid soluble molecules. The receptors bind to a group of DNA binding proteins. Upon binding, the receptor-ligand complex translocates to the nucleus where they can alter patterns of gene expression. Steroid hormone receptors are found in the nucleus, cytosol, and also on the plasma membrane of target cells. They are generally intracellular receptors (typically cytoplasmic or nuclear) and initiate signal transduction for steroid hormones which lead to changes in gene expression over a time period of hours to days. The best studied steroid hormone receptors are members of the nuclear receptor subfamily 3 (NR3) that include receptors for estrogen (group NR3A) and 3-ketosteroids (group NR3C). In addition to nuclear receptors, several G protein-coupled receptors and ion channels act as cell surface receptors for certain steroid hormones.
Sources: en.wikipedia.org
A Ziehl–Neelsen stain is an acid-fast stain used to stain species of Mycobacterium tuberculosis that do not stain with the standard laboratory staining procedures such as Gram staining. This stain is performed through the use of both red coloured carbol fuchsin that stains the bacteria and a counter stain such as methylene blue.
== Chemistry == Grammotoxin is a 36 amino acid protein toxin, with the sequence Asp-Cys-Val-Arg-Phe-Trp-Gly-Lys-Cys-Ser-Gln-Thr-Ser-Asp-Cys-Cys-Pro-His-Leu-Ala-Cys-Lys-Ser-Lys-Trp-Pro-Arg-Asn-Ile-Cys-Val-Trp-Asp-Gly-Ser-Val (DCVRFWGKCSQTSDCCPHLACKSKWPRNICVWDGSV), and disulfide bridges between Cys2-Cys16, Cys9-Cys21 and Cys15-Cys30. It forms an inhibitor cystine knot motif, common in spider toxins. Its chemical formula is: C177H268N52O50S6 Grammotoxin can be purified from Grammostola spatulata venom by reverse phase high performance liquid chromatography.
The recommended daily intakes for children aged three years and older is 10% to 20% higher than adult levels and those for infants can be as much as 150% higher in the first year of life. Cysteine (or sulfur-containing amino acids), tyrosine (or aromatic amino acids), and arginine are always required by infants and growing children. Methionine and cysteine are grouped together because one of them can be synthesized from the other using the enzyme methionine S-methyltransferase and the catalyst methionine synthase. Phenylalanine and tyrosine are grouped together because tyrosine can be synthesized from phenylalanine using the enzyme phenylalanine hydroxylase.
Sources: en.wikipedia.org
It consists mainly of animal experiments and small clinical reports, with much of the clinical material published in Russian-language journals. Large independent trials are scarce. Separating reliable effects from chance findings is consequently difficult.
A fraction of an intranasal dose is thought to reach the central nervous system, and this route is favoured partly for that reason. The proportion is not well characterized. Direct measurement in humans remains difficult with current methods.
Raised BDNF and NGF expression has been reported across several animal studies, which makes the signal fairly consistent. Whether the same change occurs in humans at usable doses is not established. It is best treated as a working hypothesis rather than a confirmed clinical mechanism.
It originated at the Institute of Molecular Genetics in Moscow during the 1980s. The work was carried out by a Russian research group that specialized in peptide neuropharmacology.